KIF15 Antikörper (Middle Region)

Produktnummer ABIN634134

Produktdetails anti-KIF15 Antikörper

Target: KIF15 (Kinesin Family Member 15 (KIF15))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIF15 antibody was raised against the middle region of KIF15

Aufreinigung: Affinity purified

Immunogen: KIF15 antibody was raised using the middle region of KIF15 corresponding to a region with amino acids SKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF15 Blocking Peptide, catalog no. 33R-8556, is also available for use as a blocking control in assays to test for specificity of this KIF15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF15

Target: KIF15 (Kinesin Family Member 15 (KIF15))

Andere Bezeichnung: KIF15 (KIF15 Produkte)

Synonyme: XKlp2 antikoerper, kif15 antikoerper, klp2 antikoerper, KIF15 antikoerper, si:dkey-108k21.1 antikoerper, wu:fb96c12 antikoerper, wu:fc51g12 antikoerper, wu:fe01e02 antikoerper, HKLP2 antikoerper, KNSL7 antikoerper, NY-BR-62 antikoerper, 3110023M17Rik antikoerper, 3930402I10Rik antikoerper, D330038N01 antikoerper, Knsl7 antikoerper, b2b1117.1Clo antikoerper, kinesin family member 15 L homeolog antikoerper, kinesin family member 15 antikoerper, kinesin family member 15 S homeolog antikoerper, zinc finger protein 660 antikoerper, kif15.L antikoerper, KIF15 antikoerper, kif15.S antikoerper, kif15 antikoerper, Kif15 antikoerper, ZNF660 antikoerper

Hintergrund: KIF15 is the plus-end directed kinesin-like motor enzyme involved in mitotic spindle assembly.

Molekulargewicht: 160 kDa (MW of target protein)