RFC3 Antikörper
-
- Target Alle RFC3 Antikörper anzeigen
- RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RFC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF
- Top Product
- Discover our top product RFC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RFC3 Blocking Peptide, catalog no. 33R-4003, is also available for use as a blocking control in assays to test for specificity of this RFC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))
- Andere Bezeichnung
- RFC3 (RFC3 Produkte)
- Synonyme
- CG5313 antikoerper, DRFC antikoerper, DmRFC3 antikoerper, Dmel\\CG5313 antikoerper, Rfc3 antikoerper, 21.m02902 antikoerper, 2810416I22Rik antikoerper, 38kDa antikoerper, AU022547 antikoerper, Recc3 antikoerper, cb275 antikoerper, RFC38 antikoerper, Replication factor C subunit 3 antikoerper, replication factor C3 antikoerper, replication factor C subunit 3 antikoerper, replication factor C 38 kDa subunit antikoerper, DNA replication factor C complex subunit Rfc3 antikoerper, replication factor C3, putative antikoerper, replication factor C (activator 1) 3 antikoerper, replication factor C subunit 3 L homeolog antikoerper, RfC3 antikoerper, PF14_0601 antikoerper, Chro.30359 antikoerper, PB000006.01.0 antikoerper, PC000345.04.0 antikoerper, TP04_0380 antikoerper, Tb09.211.3310 antikoerper, PY04255 antikoerper, PVX_117300 antikoerper, BBOV_IV003080 antikoerper, SJAG_02182 antikoerper, PKH_124240 antikoerper, rfc3 antikoerper, Rfc3 antikoerper, RFC3 antikoerper, rfc3.L antikoerper
- Hintergrund
- The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Telomere Maintenance, DNA Reparatur, DNA Replication, Synthesis of DNA
-