VPS29 Antikörper
-
- Target Alle VPS29 Antikörper anzeigen
- VPS29 (Vacuolar Protein Sorting 29 (VPS29))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VPS29 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL
- Top Product
- Discover our top product VPS29 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VPS29 Blocking Peptide, catalog no. 33R-4834, is also available for use as a blocking control in assays to test for specificity of this VPS29 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS29 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPS29 (Vacuolar Protein Sorting 29 (VPS29))
- Andere Bezeichnung
- VPS29 (VPS29 Produkte)
- Synonyme
- DC15 antikoerper, PEP11 antikoerper, 2010015D08Rik antikoerper, AW049835 antikoerper, VPS29 antikoerper, fb06g05 antikoerper, wu:fb06g05 antikoerper, zgc:56191 antikoerper, zgc:86638 antikoerper, VPT6 antikoerper, DDBDRAFT_0188107 antikoerper, DDBDRAFT_0234192 antikoerper, DDB_0188107 antikoerper, DDB_0234192 antikoerper, vps29 antikoerper, 17.m07782 antikoerper, ATVPS29 antikoerper, MAIGO 1 antikoerper, VACUOLAR PROTEIN SORTING 29 antikoerper, VPS29, retromer complex component antikoerper, VPS29 retromer complex component antikoerper, vacuolar protein sorting 29 homolog (S. cerevisiae) antikoerper, retromer subunit VPS29 antikoerper, retromer subunit antikoerper, protein involved in endosome to golgi protein transport antikoerper, subunit of retromer complex antikoerper, metallophosphoesterase domain-containing protein antikoerper, VPS29 retromer complex component S homeolog antikoerper, vacuolar protein sorting-associated protein 29 antikoerper, vacuolar protein sorting 29 antikoerper, Calcineurin-like metallo-phosphoesterase superfamily protein antikoerper, vacuolar protein sorting 29 homolog antikoerper, retromer complex subunit Vps29 antikoerper, VPS29 antikoerper, Vps29 antikoerper, vps29 antikoerper, CAALFM_C100320WA antikoerper, vps29.S antikoerper, ANI_1_150074 antikoerper, AOR_1_1618194 antikoerper, CpipJ_CPIJ011219 antikoerper, MCYG_08523 antikoerper, PITG_21643 antikoerper, MGYG_08674 antikoerper, LOC733048 antikoerper, cgd7_2060 antikoerper, PVX_086095 antikoerper, BBOV_III008970 antikoerper, CMU_034100 antikoerper, LOC100281359 antikoerper, MAG1 antikoerper, TERG_02857 antikoerper, Tsp_08912a antikoerper, Tsp_08912 antikoerper, Tsp_08917 antikoerper
- Hintergrund
- This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex.
- Molekulargewicht
- 20 kDa (MW of target protein)
-