SERPINI2 Antikörper

Produktnummer ABIN634053

Produktdetails anti-SERPINI2 Antikörper

Target: SERPINI2 (serpin Peptidase Inhibitor, Clade I (Pancpin), Member 2 (SERPINI2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SERPINI2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SERPINI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERPINI2 Blocking Peptide, catalog no. 33R-5285, is also available for use as a blocking control in assays to test for specificity of this SERPINI2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINI2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SERPINI2

Target: SERPINI2 (serpin Peptidase Inhibitor, Clade I (Pancpin), Member 2 (SERPINI2))

Andere Bezeichnung: SERPINI2 (SERPINI2 Produkte)

Synonyme: Spi14 antikoerper, MEPI antikoerper, PANCPIN antikoerper, PI14 antikoerper, TSA2004 antikoerper, serpin family I member 2 antikoerper, serpin peptidase inhibitor, clade I (pancpin), member 2 L homeolog antikoerper, serpin peptidase inhibitor, clade I (pancpin), member 2 antikoerper, serine (or cysteine) peptidase inhibitor, clade I, member 2 antikoerper, SERPINI2 antikoerper, serpini2.L antikoerper, Serpini2 antikoerper

Hintergrund: The protein encoded by this gene is a member of the serine protease inhibitor (serpin) superfamily made up of proteins which play central roles in the regulation of a wide variety of physiological processes, including coagulation and fibrinolysis.

Molekulargewicht: 46 kDa (MW of target protein)