PSG5 Antikörper (Middle Region)
-
- Target Alle PSG5 Antikörper anzeigen
- PSG5 (Pregnancy Specific beta-1-Glycoprotein 5 (PSG5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSG5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PSG5 antibody was raised against the middle region of PSG5
- Aufreinigung
- Affinity purified
- Immunogen
- PSG5 antibody was raised using the middle region of PSG5 corresponding to a region with amino acids SIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI
- Top Product
- Discover our top product PSG5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSG5 Blocking Peptide, catalog no. 33R-8536, is also available for use as a blocking control in assays to test for specificity of this PSG5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSG5 (Pregnancy Specific beta-1-Glycoprotein 5 (PSG5))
- Andere Bezeichnung
- PSG5 (PSG5 Produkte)
- Hintergrund
- The pregnancy-specific beta 1 glycoprotein (PSG) is a group of heterogeneous proteins produced in large amounts by the human syncytiotrophoblast. They belong to the carcinoembryonic antigen (CEA) family. The function of PSG5 remains unknown.
- Molekulargewicht
- 38 kDa (MW of target protein)
-