ENPP6 Antikörper (Middle Region)

Produktnummer ABIN633965

Produktdetails anti-ENPP6 Antikörper

Target: ENPP6 (Ectonucleotide pyrophosphatase/phosphodiesterase 6 (ENPP6))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ENPP6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ENPP6 antibody was raised against the middle region of ENPP6

Aufreinigung: Affinity purified

Immunogen: ENPP6 antibody was raised using the middle region of ENPP6 corresponding to a region with amino acids ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ENPP6 Blocking Peptide, catalog no. 33R-2561, is also available for use as a blocking control in assays to test for specificity of this ENPP6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENPP6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ENPP6

Target: ENPP6 (Ectonucleotide pyrophosphatase/phosphodiesterase 6 (ENPP6))

Andere Bezeichnung: ENPP6 (ENPP6 Produkte)

Synonyme: E-NPP 6 antikoerper, cb1028 antikoerper, sb:cb727 antikoerper, zgc:103605 antikoerper, NPP6 antikoerper, NPP-6 antikoerper, 4833421B01Rik antikoerper, B830047L21Rik antikoerper, D8Ertd514e antikoerper, Npp6 antikoerper, E-NPP6 antikoerper, ectonucleotide pyrophosphatase/phosphodiesterase 6 antikoerper, ectonucleotide pyrophosphatase/phosphodiesterase 6 L homeolog antikoerper, enpp6 antikoerper, enpp6.L antikoerper, ENPP6 antikoerper, Enpp6 antikoerper

Hintergrund: ENPP6 is a choline-specific glycerophosphodiester phosphodiesterase. ENPP6 hydrolyzes the classical substrate for phospholipase C, p-nitrophenyl phosphorylcholine, while it does not hydrolyze the classical nucleotide phosphodiesterase substrate, p-nitrophenyl thymidine 5'-monophosphate.

Molekulargewicht: 50 kDa (MW of target protein)