PNPLA4 Antikörper (C-Term)

Produktnummer ABIN633942

Produktdetails anti-PNPLA4 Antikörper

Target: PNPLA4 (Patatin-Like phospholipase Domain Containing 4 (PNPLA4))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNPLA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PNPLA4 antibody was raised against the C terminal of PNPLA4

Aufreinigung: Affinity purified

Immunogen: PNPLA4 antibody was raised using the C terminal of PNPLA4 corresponding to a region with amino acids SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNPLA4 Blocking Peptide, catalog no. 33R-8673, is also available for use as a blocking control in assays to test for specificity of this PNPLA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNPLA4

Target: PNPLA4 (Patatin-Like phospholipase Domain Containing 4 (PNPLA4))

Andere Bezeichnung: PNPLA4 (PNPLA4 Produkte)

Synonyme: PNPLA4 antikoerper, DXS1283E antikoerper, GS2 antikoerper, iPLA2eta antikoerper, patatin like phospholipase domain containing 4 L homeolog antikoerper, patatin like phospholipase domain containing 4 antikoerper, pnpla4.L antikoerper, PNPLA4 antikoerper

Hintergrund: PNPLA4 is a keratinocyte retinyl ester hydrolase. The protein also catalyzes fatty acyl CoA-dependent and independent retinol esterification, using triolein as substrate and generates diacylglyceride and free fatty acid.

Molekulargewicht: 28 kDa (MW of target protein)