Albumin Antikörper (Middle Region)

Produktnummer ABIN633910

Produktdetails anti-Albumin Antikörper

Target: Albumin (ALB)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Albumin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Albumin antibody was raised against the middle region of ALB

Aufreinigung: Affinity purified

Immunogen: Albumin antibody was raised using the middle region of ALB corresponding to a region with amino acids LSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Albumin Blocking Peptide, catalog no. 33R-5421, is also available for use as a blocking control in assays to test for specificity of this Albumin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-Albumin Antikörper (ABIN633910)

Canuel, Bhattacharyya, Balbis, Yuan, Morales: "Sortilin and prosaposin localize to detergent-resistant membrane microdomains." in: Experimental cell research, Vol. 315, Issue 2, pp. 240-7, (2008) (PubMed).

Clavant, Sastra, Osicka, Comper: "The analysis and characterisation of immuno-unreactive urinary albumin in healthy volunteers." in: Clinical biochemistry, Vol. 39, Issue 2, pp. 143-51, (2006) (PubMed).

Details zu Albumin

Target: Albumin (ALB)

Andere Bezeichnung: Albumin (ALB Produkte)

Synonyme: PRO0883 antikoerper, PRO0903 antikoerper, PRO1341 antikoerper, ALB antikoerper, CSA antikoerper, Alb-1 antikoerper, Alb1 antikoerper, Albza antikoerper, LOC100136344 antikoerper, alb-a antikoerper, alb-b antikoerper, albumin antikoerper, serum albumin 1 antikoerper, albumin S homeolog antikoerper, ALB antikoerper, Alb antikoerper, LOC100136344 antikoerper, alb.S antikoerper

Hintergrund: Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: Lipid Metabolism