NDUFS3 Antikörper (Middle Region)

Produktnummer ABIN633898

Produktdetails anti-NDUFS3 Antikörper

Target: NDUFS3 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 3, 30kDa (NADH-Coenzyme Q Reductase) (NDUFS3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDUFS3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NDUFS3 antibody was raised against the middle region of NDUFS3

Aufreinigung: Affinity purified

Immunogen: NDUFS3 antibody was raised using the middle region of NDUFS3 corresponding to a region with amino acids EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDUFS3 Blocking Peptide, catalog no. 33R-2797, is also available for use as a blocking control in assays to test for specificity of this NDUFS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDUFS3

Target: NDUFS3 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 3, 30kDa (NADH-Coenzyme Q Reductase) (NDUFS3))

Andere Bezeichnung: NDUFS3 (NDUFS3 Produkte)

Synonyme: CI-30 antikoerper, 0610010M09Rik antikoerper, CI-30kD antikoerper, GB15355 antikoerper, zgc:112520 antikoerper, NADH:ubiquinone oxidoreductase core subunit S3 antikoerper, NADH dehydrogenase (ubiquinone) Fe-S protein 3 antikoerper, NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial antikoerper, NADH:ubiquinone oxidoreductase core subunit S3 S homeolog antikoerper, NADH dehydrogenase (ubiquinone) Fe-S protein 3, (NADH-coenzyme Q reductase) antikoerper, NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase) antikoerper, NDUFS3 antikoerper, Ndufs3 antikoerper, ndufs3 antikoerper, LOC411411 antikoerper, ndufs3.S antikoerper, LOC100228726 antikoerper

Hintergrund: This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: Negative Regulation of intrinsic apoptotic Signaling