IGFBP2 Antikörper (Middle Region)
-
- Target Alle IGFBP2 Antikörper anzeigen
- IGFBP2 (Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IGFBP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IGFBP2 antibody was raised against the middle region of IGFBP2
- Aufreinigung
- Affinity purified
- Immunogen
- IGFBP2 antibody was raised using the middle region of IGFBP2 corresponding to a region with amino acids KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ
- Top Product
- Discover our top product IGFBP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IGFBP2 Blocking Peptide, catalog no. 33R-4590, is also available for use as a blocking control in assays to test for specificity of this IGFBP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFBP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGFBP2 (Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2))
- Andere Bezeichnung
- IGFBP2 (IGFBP2 Produkte)
- Synonyme
- IBP2 antikoerper, IGF-BP53 antikoerper, AI255832 antikoerper, IBP-2 antikoerper, Igfbp-2 antikoerper, mIGFBP-2 antikoerper, IGFBP-2 antikoerper, ILGFBPA antikoerper, pIGFBP-2 antikoerper, igfbp2 antikoerper, MGC65741 antikoerper, MGC76823 antikoerper, MGC174445 antikoerper, IGFBP2 antikoerper, ibp2 antikoerper, igf-bp53 antikoerper, igfbp2a antikoerper, si:ch211-2k18.3 antikoerper, insulin like growth factor binding protein 2 antikoerper, insulin-like growth factor binding protein 2 antikoerper, insulin-like growth factor binding protein 2a antikoerper, insulin-like growth factor binding protein 2b antikoerper, IGFBP2 antikoerper, Igfbp2 antikoerper, igfbp2a antikoerper, igfbp2 antikoerper, igfbp2b antikoerper
- Hintergrund
- IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Growth Factor Binding, Activated T Cell Proliferation
-