MST1 Antikörper

Produktnummer ABIN633854

Produktdetails anti-MST1 Antikörper

Target: MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MST1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MST1 Blocking Peptide, catalog no. 33R-8329, is also available for use as a blocking control in assays to test for specificity of this MST1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MST1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MST1

Target: MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))

Andere Bezeichnung: MST1 (MST1 Produkte)

Synonyme: D3F15S2 antikoerper, DNF15S2 antikoerper, HGFL antikoerper, MSP antikoerper, NF15S2 antikoerper, E2F2 antikoerper, D3F15S2h antikoerper, D9H3F15S2 antikoerper, DNF15S2h antikoerper, Hgfl antikoerper, HGF1/MSP antikoerper, E1A antikoerper, XHL antikoerper, d3f15s2 antikoerper, dnf15s2 antikoerper, hgfl antikoerper, msp antikoerper, mst1 antikoerper, nf15s2 antikoerper, macrophage stimulating 1 antikoerper, macrophage stimulating 1 (hepatocyte growth factor-like) antikoerper, serine/threonine kinase 4 antikoerper, macrophage stimulating 1 L homeolog antikoerper, MST1 antikoerper, Mst1 antikoerper, STK4 antikoerper, mst1.L antikoerper

Hintergrund: MST1 belongs to the peptidase S1 family, plasminogen subfamily. It contains 4 kringle domains, 1 PAN domain and 1 peptidase S1 domain. MST1 probably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved.

Molekulargewicht: 80 kDa (MW of target protein)