TRAPPC4 Antikörper (Middle Region)

Produktnummer ABIN633833

Produktdetails anti-TRAPPC4 Antikörper

Target: TRAPPC4 (Trafficking Protein Particle Complex 4 (TRAPPC4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRAPPC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRAPPC4 antibody was raised against the middle region of TRAPPC4

Aufreinigung: Affinity purified

Immunogen: TRAPPC4 antibody was raised using the middle region of TRAPPC4 corresponding to a region with amino acids EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRAPPC4 Blocking Peptide, catalog no. 33R-2512, is also available for use as a blocking control in assays to test for specificity of this TRAPPC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRAPPC4

Target: TRAPPC4 (Trafficking Protein Particle Complex 4 (TRAPPC4))

Andere Bezeichnung: TRAPPC4 (TRAPPC4 Produkte)

Synonyme: HSPC172 antikoerper, PTD009 antikoerper, SBDN antikoerper, SYNBINDIN antikoerper, TRS23 antikoerper, 1500017G03Rik antikoerper, AI303617 antikoerper, Sbd antikoerper, Sbdn antikoerper, Sdcbp2 antikoerper, zgc:73260 antikoerper, TRAPPC4 antikoerper, MGC131237 antikoerper, sbdn antikoerper, trs23 antikoerper, ptd009 antikoerper, cgi-104 antikoerper, hspc172 antikoerper, trafficking protein particle complex 4 antikoerper, trafficking protein particle complex 4 S homeolog antikoerper, TRAPPC4 antikoerper, Trappc4 antikoerper, trappc4 antikoerper, trappc4.S antikoerper

Hintergrund: TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Molekulargewicht: 24 kDa (MW of target protein)