TR4 Antikörper (N-Term)
-
- Target Alle TR4 (NR2C2) Antikörper anzeigen
- TR4 (NR2C2) (Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TR4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NR2 C2 antibody was raised against the N terminal of NR2 2
- Aufreinigung
- Affinity purified
- Immunogen
- NR2 C2 antibody was raised using the N terminal of NR2 2 corresponding to a region with amino acids INKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAASTEK
- Top Product
- Discover our top product NR2C2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NR2C2 Blocking Peptide, catalog no. 33R-4073, is also available for use as a blocking control in assays to test for specificity of this NR2C2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TR4 (NR2C2) (Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2))
- Andere Bezeichnung
- NR2C2 (NR2C2 Produkte)
- Synonyme
- TAK1 antikoerper, TR2R1 antikoerper, TR4 antikoerper, hTAK1 antikoerper, Tr4 antikoerper, gb:dq017625 antikoerper, im:6911408 antikoerper, mKIAA4145 antikoerper, nuclear receptor subfamily 2 group C member 2 antikoerper, nuclear receptor subfamily 2, group C, member 2 antikoerper, NR2C2 antikoerper, Nr2c2 antikoerper, nr2c2 antikoerper
- Hintergrund
- Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes.
- Molekulargewicht
- 67 kDa (MW of target protein)
- Pathways
- T-Zell Rezeptor Signalweg, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Tube Formation, Toll-Like Receptors Cascades
-