NR2E1 Antikörper (Middle Region)

Produktnummer ABIN633801

Produktdetails anti-NR2E1 Antikörper

Target: NR2E1 (Nuclear Receptor Subfamily 2, Group E, Member 1 (NR2E1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR2E1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NR2 E1 antibody was raised against the middle region of NR2 1

Aufreinigung: Affinity purified

Immunogen: NR2 E1 antibody was raised using the middle region of NR2 1 corresponding to a region with amino acids LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NR2E1 Blocking Peptide, catalog no. 33R-4758, is also available for use as a blocking control in assays to test for specificity of this NR2E1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NR2E1

Target: NR2E1 (Nuclear Receptor Subfamily 2, Group E, Member 1 (NR2E1))

Andere Bezeichnung: NR2E1 (NR2E1 Produkte)

Synonyme: NR2E1 antikoerper, TLL antikoerper, TLX antikoerper, XTLL antikoerper, Mtl1 antikoerper, Mtll antikoerper, Tlx antikoerper, fierce antikoerper, frc antikoerper, tailless antikoerper, fc30e03 antikoerper, fc39f12 antikoerper, wu:fc30e03 antikoerper, wu:fc39f12 antikoerper, zgc:100991 antikoerper, Xtll antikoerper, nr2e1-A antikoerper, tlx antikoerper, nuclear receptor subfamily 2 group E member 1 antikoerper, nuclear receptor subfamily 2, group E, member 1 antikoerper, nuclear receptor subfamily 2 group E member 1 S homeolog antikoerper, NR2E1 antikoerper, Nr2e1 antikoerper, nr2e1 antikoerper, nr2e1.S antikoerper

Hintergrund: The NR2E1 gene is a member of the steroid nuclear receptor superfamily and is predominately expressed in the brain. The contributions of this gene to human B-cell leukemia and to brain development are unknown at present.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Stem Cell Maintenance