GRIK5 Antikörper (Middle Region)

Produktnummer ABIN633785

Produktdetails anti-GRIK5 Antikörper

Target: GRIK5 (Glutamate Receptor, Ionotropic, Kainate 5 (GRIK5))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRIK5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GRIK5 antibody was raised against the middle region of GRIK5

Aufreinigung: Affinity purified

Immunogen: GRIK5 antibody was raised using the middle region of GRIK5 corresponding to a region with amino acids EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRIK5 Blocking Peptide, catalog no. 33R-2313, is also available for use as a blocking control in assays to test for specificity of this GRIK5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIK5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRIK5

Target: GRIK5 (Glutamate Receptor, Ionotropic, Kainate 5 (GRIK5))

Andere Bezeichnung: GRIK5 (GRIK5 Produkte)

Synonyme: EAA2 antikoerper, GRIK2 antikoerper, GluK5 antikoerper, KA2 antikoerper, GRIK5 antikoerper, Glur6 antikoerper, ka2 antikoerper, eaa2 antikoerper, GluRgamma2 antikoerper, iGlu5 antikoerper, glutamate ionotropic receptor kainate type subunit 5 antikoerper, glutamate receptor, ionotropic, kainate 5 antikoerper, glutamate ionotropic receptor kainate type subunit 2 antikoerper, glutamate receptor, ionotropic, kainate 5 L homeolog antikoerper, glutamate receptor, ionotropic, kainate 5 (gamma 2) antikoerper, GRIK5 antikoerper, GRIK2 antikoerper, grik5 antikoerper, grik5.L antikoerper, Grik5 antikoerper

Hintergrund: GRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.

Molekulargewicht: 108 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Synaptic Membrane, Maintenance of Protein Location, Synaptic Vesicle Exocytosis