KCNG1 Antikörper (N-Term)
-
- Target Alle KCNG1 Antikörper anzeigen
- KCNG1 (Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNG1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNG1 antibody was raised against the N terminal of KCNG1
- Aufreinigung
- Affinity purified
- Immunogen
- KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD
- Top Product
- Discover our top product KCNG1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNG1 Blocking Peptide, catalog no. 33R-6552, is also available for use as a blocking control in assays to test for specificity of this KCNG1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNG1 (Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1))
- Andere Bezeichnung
- KCNG1 (KCNG1 Produkte)
- Synonyme
- kcng1 antikoerper, MGC122787 antikoerper, K13 antikoerper, KCNG antikoerper, KV6.1 antikoerper, kH2 antikoerper, AW536275 antikoerper, OTTMUSG00000016048 antikoerper, Kh2 antikoerper, Kv6.1 antikoerper, potassium channel, voltage gated modifier subfamily G, member 1 antikoerper, potassium voltage-gated channel modifier subfamily G member 1 antikoerper, potassium voltage-gated channel, subfamily G, member 1 antikoerper, kcng1 antikoerper, KCNG1 antikoerper, Kcng1 antikoerper
- Hintergrund
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G.
- Molekulargewicht
- 58 kDa (MW of target protein)
-