TRPV5 Antikörper (N-Term)

Produktnummer ABIN633749

Produktdetails anti-TRPV5 Antikörper

Target: TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRPV5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRPV5 antibody was raised against the N terminal of TRPV5

Aufreinigung: Affinity purified

Immunogen: TRPV5 antibody was raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRPV5 Blocking Peptide, catalog no. 33R-6206, is also available for use as a blocking control in assays to test for specificity of this TRPV5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRPV5

Target: TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))

Andere Bezeichnung: TRPV5 (TRPV5 Produkte)

Synonyme: CaT2 antikoerper, Ecac1 antikoerper, CAT2 antikoerper, ECAC1 antikoerper, OTRPC3 antikoerper, D630033B11 antikoerper, TRPV5 antikoerper, ECAC antikoerper, cat2 antikoerper, xcat2 antikoerper, transient receptor potential cation channel, subfamily V, member 5 antikoerper, transient receptor potential cation channel subfamily V member 5 antikoerper, calcium transporter 2 L homeolog antikoerper, Trpv5 antikoerper, TRPV5 antikoerper, LOC100011049 antikoerper, trpv5 antikoerper, cat2.L antikoerper

Hintergrund: TRPV5 is a member of the transient receptor family and the TrpV subfamily. TRPV5, a calcium-selective channel, has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. TRPV5 forms homotetramers or heterotetramers and is activated by a low internal calcium level.

Molekulargewicht: 82 kDa (MW of target protein)