TRPC6 Antikörper (N-Term)
-
- Target Alle TRPC6 Antikörper anzeigen
- TRPC6 (Transient Receptor Potential Cation Channel, Subfamily C, Member 6 (TRPC6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRPC6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRPC6 antibody was raised against the N terminal of TRPC6
- Aufreinigung
- Affinity purified
- Immunogen
- TRPC6 antibody was raised using the N terminal of TRPC6 corresponding to a region with amino acids MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC
- Top Product
- Discover our top product TRPC6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRPC6 Blocking Peptide, catalog no. 33R-6482, is also available for use as a blocking control in assays to test for specificity of this TRPC6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPC6 (Transient Receptor Potential Cation Channel, Subfamily C, Member 6 (TRPC6))
- Andere Bezeichnung
- TRPC6 (TRPC6 Produkte)
- Synonyme
- FSGS2 antikoerper, TRP6 antikoerper, AV025995 antikoerper, LLHWJM002 antikoerper, LLHWJM003 antikoerper, LLHWJM004 antikoerper, TRP-6 antikoerper, Trrp6 antikoerper, mtrp6 antikoerper, trp6 antikoerper, bZ1P14.9 antikoerper, si:rp71-1p14.9 antikoerper, trpc6 antikoerper, transient receptor potential cation channel subfamily C member 6 antikoerper, transient receptor potential cation channel, subfamily C, member 6 antikoerper, transient receptor potential cation channel, subfamily C, member 6a antikoerper, TRPC6 antikoerper, Trpc6 antikoerper, trpc6a antikoerper, trpc6 antikoerper
- Hintergrund
- TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).
- Molekulargewicht
- 106 kDa (MW of target protein)
-