KCNMB3 Antikörper (Middle Region)
-
- Target Alle KCNMB3 Antikörper anzeigen
- KCNMB3 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M beta Member 3 (KCNMB3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNMB3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNMB3 antibody was raised against the middle region of KCNMB3
- Aufreinigung
- Affinity purified
- Immunogen
- KCNMB3 antibody was raised using the middle region of KCNMB3 corresponding to a region with amino acids SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC
- Top Product
- Discover our top product KCNMB3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNMB3 Blocking Peptide, catalog no. 33R-8629, is also available for use as a blocking control in assays to test for specificity of this KCNMB3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNMB3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNMB3 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M beta Member 3 (KCNMB3))
- Andere Bezeichnung
- KCNMB3 (KCNMB3 Produkte)
- Synonyme
- KCNMB3 antikoerper, BKBETA3 antikoerper, HBETA3 antikoerper, KCNMB2 antikoerper, KCNMBL antikoerper, SLOBETA3 antikoerper, EG435726 antikoerper, Gm5707 antikoerper, potassium calcium-activated channel subfamily M regulatory beta subunit 3 antikoerper, potassium channel subfamily M regulatory beta subunit 3 S homeolog antikoerper, potassium large conductance calcium-activated channel, subfamily M beta member 3 antikoerper, potassium large conductance calcium-activated channel, subfamily M, beta member 3 antikoerper, KCNMB3 antikoerper, kcnmb3.S antikoerper, Kcnmb3 antikoerper
- Hintergrund
- KCNMB3 is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. At least four transcript variants encoding four different isoforms have been found for KCNMB3.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit.
- Molekulargewicht
- 31 kDa (MW of target protein)
-