TRPV4 Antikörper (Middle Region)

Produktnummer ABIN633742

Produktdetails anti-TRPV4 Antikörper

Target: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRPV4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRPV4 antibody was raised against the middle region of TRPV4

Aufreinigung: Affinity purified

Immunogen: TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRPV4 Blocking Peptide, catalog no. 33R-8240, is also available for use as a blocking control in assays to test for specificity of this TRPV4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRPV4

Target: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Andere Bezeichnung: TRPV4 (TRPV4 Produkte)

Synonyme: wu:fp52e02 antikoerper, CMT2C antikoerper, HMSN2C antikoerper, OTRPC4 antikoerper, SMAL antikoerper, SPSMA antikoerper, SSQTL1 antikoerper, TRP12 antikoerper, VRL2 antikoerper, VROAC antikoerper, 0610033B08Rik antikoerper, Trp12 antikoerper, VR-OAC antikoerper, VRL-2 antikoerper, Otrpc4 antikoerper, Vroac antikoerper, transient receptor potential cation channel, subfamily V, member 4 antikoerper, transient receptor potential cation channel subfamily V member 4 antikoerper, trpv4 antikoerper, TRPV4 antikoerper, Trpv4 antikoerper

Hintergrund: TRPV4 is a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. TRPV4 is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure.

Molekulargewicht: 91 kDa (MW of target protein)

Pathways: Hormone Transport, Cell-Cell Junction Organization