TRPV4 Antikörper (Middle Region)

Produktnummer ABIN633737

Produktdetails anti-TRPV4 Antikörper

Target: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRPV4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRPV4 antibody was raised against the middle region of TRPV4

Aufreinigung: Affinity purified

Immunogen: TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRPV4 Blocking Peptide, catalog no. 33R-8239, is also available for use as a blocking control in assays to test for specificity of this TRPV4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRPV4

Target: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Andere Bezeichnung: TRPV4 (TRPV4 Produkte)

Synonyme: wu:fp52e02 antikoerper, CMT2C antikoerper, HMSN2C antikoerper, OTRPC4 antikoerper, SMAL antikoerper, SPSMA antikoerper, SSQTL1 antikoerper, TRP12 antikoerper, VRL2 antikoerper, VROAC antikoerper, 0610033B08Rik antikoerper, Trp12 antikoerper, VR-OAC antikoerper, VRL-2 antikoerper, Otrpc4 antikoerper, Vroac antikoerper, transient receptor potential cation channel, subfamily V, member 4 antikoerper, transient receptor potential cation channel subfamily V member 4 antikoerper, trpv4 antikoerper, TRPV4 antikoerper, Trpv4 antikoerper

Hintergrund: TRPV4 is a non-selective calcium permeant cation channel probably involved in osmotic sensitivity and mechanosensitivity. Activation of TRPV4 by exposure to hypotonicity within the physiological range exhibits an outward rectification. TRPV4 also activated by low pH, citrate and phorbol esters and increase of intracellular Ca2+ potentiates currents. Channel activity seems to be regulated by a calmodulin-dependent mechanism with a negative feedback mechanism.

Molekulargewicht: 91 kDa (MW of target protein)

Pathways: Hormone Transport, Cell-Cell Junction Organization