P2RX5 Antikörper (N-Term)
-
- Target Alle P2RX5 Antikörper anzeigen
- P2RX5 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 5 (P2RX5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser P2RX5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- P2 RX5 antibody was raised against the N terminal of P2 X5
- Aufreinigung
- Affinity purified
- Immunogen
- P2 RX5 antibody was raised using the N terminal of P2 X5 corresponding to a region with amino acids LLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQR
- Top Product
- Discover our top product P2RX5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
P2RX5 Blocking Peptide, catalog no. 33R-5178, is also available for use as a blocking control in assays to test for specificity of this P2RX5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P2RX5 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 5 (P2RX5))
- Andere Bezeichnung
- P2RX5 (P2RX5 Produkte)
- Synonyme
- P2RX5 antikoerper, LRH-1 antikoerper, P2X5 antikoerper, P2X5R antikoerper, P2x5 antikoerper, purinergic receptor P2X 5 antikoerper, purinergic receptor P2X, ligand-gated ion channel, 5 antikoerper, P2RX5 antikoerper, P2rx5 antikoerper
- Hintergrund
- The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene.
- Molekulargewicht
- 47 kDa (MW of target protein)
-