Kir2.2 Antikörper (Middle Region)
-
- Target Alle Kir2.2 (KCNJ12) Antikörper anzeigen
- Kir2.2 (KCNJ12) (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 12 (KCNJ12))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Kir2.2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNJ12 antibody was raised against the middle region of KCNJ12
- Aufreinigung
- Affinity purified
- Immunogen
- KCNJ12 antibody was raised using the middle region of KCNJ12 corresponding to a region with amino acids KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR
- Top Product
- Discover our top product KCNJ12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNJ12 Blocking Peptide, catalog no. 33R-4295, is also available for use as a blocking control in assays to test for specificity of this KCNJ12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Kir2.2 (KCNJ12) (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 12 (KCNJ12))
- Andere Bezeichnung
- KCNJ12 (KCNJ12 Produkte)
- Synonyme
- IRK-2 antikoerper, IRK2 antikoerper, KCNJN1 antikoerper, Kir2.2 antikoerper, Kir2.2v antikoerper, hIRK antikoerper, hIRK1 antikoerper, hkir2.2x antikoerper, kcnj12x antikoerper, Kir2.1 antikoerper, IRK antikoerper, KIR2.2 antikoerper, MB-IRK2 antikoerper, potassium voltage-gated channel subfamily J member 12 antikoerper, ATP-sensitive inward rectifier potassium channel 12 antikoerper, potassium inwardly-rectifying channel, subfamily J, member 12 antikoerper, KCNJ12 antikoerper, LOC746628 antikoerper, Kcnj12 antikoerper
- Hintergrund
- KCNJ12 is an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). This gene is located within the Smith-Magenis syndrome region on chromosome 17.
- Molekulargewicht
- 49 kDa (MW of target protein)
-