CACNA1G Antikörper (Middle Region)

Produktnummer ABIN633723

Produktdetails anti-CACNA1G Antikörper

Target: CACNA1G (Calcium Channel, Voltage-Dependent, T Type, alpha 1G Subunit (CACNA1G))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CACNA1G Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CACNA1 G antibody was raised against the middle region of CACNA1

Aufreinigung: Affinity purified

Immunogen: CACNA1 G antibody was raised using the middle region of CACNA1 corresponding to a region with amino acids VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CACNA1G Blocking Peptide, catalog no. 33R-9823, is also available for use as a blocking control in assays to test for specificity of this CACNA1G antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CACNA1G

Target: CACNA1G (Calcium Channel, Voltage-Dependent, T Type, alpha 1G Subunit (CACNA1G))

Andere Bezeichnung: CACNA1G (CACNA1G Produkte)

Synonyme: CACNA1G antikoerper, cav3.1 antikoerper, ca(v)3.1 antikoerper, Ca(V)T.1 antikoerper, Cav3.1 antikoerper, NBR13 antikoerper, Cav3.1d antikoerper, [a]1G antikoerper, a1G antikoerper, alpha-1G antikoerper, mKIAA1123 antikoerper, Ca(v)3.1 antikoerper, calcium voltage-gated channel subunit alpha1 G antikoerper, calcium channel, voltage-dependent, T type, alpha 1G subunit antikoerper, calcium channel, voltage-dependent, T type, alpha 1G subunit L homeolog antikoerper, CACNA1G antikoerper, cacna1g antikoerper, cacna1g.L antikoerper, Cacna1g antikoerper

Hintergrund: Voltage-activated calcium channels can be distinguished based on their voltage-dependence, deactivation, and single-channel conductance.

Molekulargewicht: 241 kDa (MW of target protein)