CHRFAM7A Antikörper (N-Term)

Produktnummer ABIN633716

Produktdetails anti-CHRFAM7A Antikörper

Target: CHRFAM7A (CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHRFAM7A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHRFAM7 A antibody was raised against the N terminal of CHRFAM7

Aufreinigung: Affinity purified

Immunogen: CHRFAM7 A antibody was raised using the N terminal of CHRFAM7 corresponding to a region with amino acids QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHRFAM7A Blocking Peptide, catalog no. 33R-7550, is also available for use as a blocking control in assays to test for specificity of this CHRFAM7A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRFAM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHRFAM7A

Target: CHRFAM7A (CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A))

Andere Bezeichnung: CHRFAM7A (CHRFAM7A Produkte)

Synonyme: CHRNA7 antikoerper, CHRNA7-DR1 antikoerper, D-10 antikoerper, CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion antikoerper, CHRFAM7A antikoerper

Hintergrund: The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7 is located on chromosome 15 in a region associated with several neuropsychiatric disorders. CHRFAM7A is is a hybrid between CHRNA7 and FAM7A.

Molekulargewicht: 45 kDa (MW of target protein)