CHRFAM7A Antikörper (N-Term)
-
- Target Alle CHRFAM7A Antikörper anzeigen
- CHRFAM7A (CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHRFAM7A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CHRFAM7 A antibody was raised against the N terminal of CHRFAM7
- Aufreinigung
- Affinity purified
- Immunogen
- CHRFAM7 A antibody was raised using the N terminal of CHRFAM7 corresponding to a region with amino acids QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC
- Top Product
- Discover our top product CHRFAM7A Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHRFAM7A Blocking Peptide, catalog no. 33R-7550, is also available for use as a blocking control in assays to test for specificity of this CHRFAM7A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRFAM0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHRFAM7A (CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A))
- Andere Bezeichnung
- CHRFAM7A (CHRFAM7A Produkte)
- Synonyme
- CHRNA7 antikoerper, CHRNA7-DR1 antikoerper, D-10 antikoerper, CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion antikoerper, CHRFAM7A antikoerper
- Hintergrund
- The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7 is located on chromosome 15 in a region associated with several neuropsychiatric disorders. CHRFAM7A is is a hybrid between CHRNA7 and FAM7A.
- Molekulargewicht
- 45 kDa (MW of target protein)
-