TRPC4 Antikörper (Middle Region)

Produktnummer ABIN633715

Produktdetails anti-TRPC4 Antikörper

Target: TRPC4 (Transient Receptor Potential Cation Channel, Subfamily C, Member 4 (TRPC4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRPC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRPC4 antibody was raised against the middle region of TRPC4

Aufreinigung: Affinity purified

Immunogen: TRPC4 antibody was raised using the middle region of TRPC4 corresponding to a region with amino acids CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRPC4 Blocking Peptide, catalog no. 33R-1763, is also available for use as a blocking control in assays to test for specificity of this TRPC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRPC4

Target: TRPC4 (Transient Receptor Potential Cation Channel, Subfamily C, Member 4 (TRPC4))

Andere Bezeichnung: TRPC4 (TRPC4 Produkte)

Synonyme: TRPC5 antikoerper, TRPC4 antikoerper, HTRP-4 antikoerper, HTRP4 antikoerper, TRP4 antikoerper, CCE1 antikoerper, STRPC4 antikoerper, Trp4 antikoerper, Trrp4 antikoerper, transient receptor potential cation channel subfamily C member 4 antikoerper, short transient receptor potential channel 4 antikoerper, transient receptor potential cation channel, subfamily C, member 4 antikoerper, TRPC4 antikoerper, LOC100538928 antikoerper, trpc4 antikoerper, Trpc4 antikoerper

Hintergrund: TRPC4 is thought to form a receptor-activated non-selective calcium permeant cation channel. TRPC4 probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. It has also been shown to be calcium-selective. TRPC4 may also be activated by intracellular calcium store depletion.

Molekulargewicht: 112 kDa (MW of target protein)