Mucolipin 3 Antikörper (Middle Region)
-
- Target Alle Mucolipin 3 (Mcoln3) Antikörper anzeigen
- Mucolipin 3 (Mcoln3)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Mucolipin 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Mucolipin 3 antibody was raised against the middle region of MCOLN3
- Aufreinigung
- Affinity purified
- Immunogen
- Mucolipin 3 antibody was raised using the middle region of MCOLN3 corresponding to a region with amino acids TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI
- Top Product
- Discover our top product Mcoln3 Primärantikörper
-
anti-Mucolipin 3 (Mcoln3) (AA 517-546), (C-Term) antibody
Mcoln3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB33939 unconjugated
anti-Mucolipin 3 (Mcoln3) (AA 201-250) antibodyMcoln3 Reaktivität: Human, Ratte, Meerschweinchen, Kaninchen, Hund, Pferd, Hamster, Affe, Schwein, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Mucolipin 3 (Mcoln3) (AA 215-264) antibodyMcoln3 Reaktivität: Human, Ratte, Maus, Meerschweinchen, Kaninchen, Rind (Kuh), Hamster, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Mucolipin 3 (Mcoln3) antibodyMcoln3 Reaktivität: Human IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Mucolipin 3 (Mcoln3) (AA 528-542), (Cytoplasmic Domain), (Intracellular) antibodyMcoln3 Reaktivität: Human, Ratte, Maus WB, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Mucolipin 3 Blocking Peptide, catalog no. 33R-9348, is also available for use as a blocking control in assays to test for specificity of this Mucolipin 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCOLN3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Mucolipin 3 (Mcoln3)
- Andere Bezeichnung
- Mucolipin 3 (Mcoln3 Produkte)
- Synonyme
- MCOLN3 antikoerper, 6720490O21Rik antikoerper, TRPML3 antikoerper, Va antikoerper, TRP-ML3 antikoerper, trp-ml3 antikoerper, trpml3 antikoerper, mucolipin 3 antikoerper, mucolipin 3 S homeolog antikoerper, MCOLN3 antikoerper, mcoln3 antikoerper, Mcoln3 antikoerper, mcoln3.S antikoerper
- Hintergrund
- Mucolipins constitute a family of cation channel proteins with homologs in mouse, Drosophila, and C. elegans. Mutations in the human MCOLN1 gene cause mucolipodosis IV.
- Molekulargewicht
- 64 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-
