KCNJ4 Antikörper (Middle Region)
-
- Target Alle KCNJ4 Antikörper anzeigen
- KCNJ4 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 4 (KCNJ4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNJ4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNJ4 antibody was raised against the middle region of KCNJ4
- Aufreinigung
- Affinity purified
- Immunogen
- KCNJ4 antibody was raised using the middle region of KCNJ4 corresponding to a region with amino acids AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI
- Top Product
- Discover our top product KCNJ4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNJ4 Blocking Peptide, catalog no. 33R-1580, is also available for use as a blocking control in assays to test for specificity of this KCNJ4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNJ4 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 4 (KCNJ4))
- Andere Bezeichnung
- KCNJ4 (KCNJ4 Produkte)
- Synonyme
- KCNJ4 antikoerper, CKIR2.3 antikoerper, HIR antikoerper, HIRK2 antikoerper, HRK1 antikoerper, IRK-3 antikoerper, IRK3 antikoerper, Kir2.3 antikoerper, Kcnf2 antikoerper, MB-IRK3 antikoerper, Hirk2 antikoerper, potassium voltage-gated channel subfamily J member 4 antikoerper, potassium inwardly-rectifying channel, subfamily J, member 4 antikoerper, KCNJ4 antikoerper, Kcnj4 antikoerper
- Hintergrund
- KCNJ4 is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family.
- Molekulargewicht
- 49 kDa (MW of target protein)
-