KCNJ4 Antikörper (Middle Region)

Produktnummer ABIN633711

Produktdetails anti-KCNJ4 Antikörper

Target: KCNJ4 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 4 (KCNJ4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNJ4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNJ4 antibody was raised against the middle region of KCNJ4

Aufreinigung: Affinity purified

Immunogen: KCNJ4 antibody was raised using the middle region of KCNJ4 corresponding to a region with amino acids AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNJ4 Blocking Peptide, catalog no. 33R-1580, is also available for use as a blocking control in assays to test for specificity of this KCNJ4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNJ4

Target: KCNJ4 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 4 (KCNJ4))

Andere Bezeichnung: KCNJ4 (KCNJ4 Produkte)

Synonyme: KCNJ4 antikoerper, CKIR2.3 antikoerper, HIR antikoerper, HIRK2 antikoerper, HRK1 antikoerper, IRK-3 antikoerper, IRK3 antikoerper, Kir2.3 antikoerper, Kcnf2 antikoerper, MB-IRK3 antikoerper, Hirk2 antikoerper, potassium voltage-gated channel subfamily J member 4 antikoerper, potassium inwardly-rectifying channel, subfamily J, member 4 antikoerper, KCNJ4 antikoerper, Kcnj4 antikoerper

Hintergrund: KCNJ4 is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family.

Molekulargewicht: 49 kDa (MW of target protein)