KCNC3 Antikörper (Middle Region)
-
- Target Alle KCNC3 Antikörper anzeigen
- KCNC3 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNC3 antibody was raised against the middle region of KCNC3
- Aufreinigung
- Affinity purified
- Immunogen
- KCNC3 antibody was raised using the middle region of KCNC3 corresponding to a region with amino acids YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM
- Top Product
- Discover our top product KCNC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNC3 Blocking Peptide, catalog no. 33R-10044, is also available for use as a blocking control in assays to test for specificity of this KCNC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNC3 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3))
- Andere Bezeichnung
- KCNC3 (KCNC3 Produkte)
- Synonyme
- kcnc3-A antikoerper, Kv3.1 antikoerper, KShIIID antikoerper, Kcr2-3 antikoerper, Kv3.3 antikoerper, KSHIIID antikoerper, KV3.3 antikoerper, SCA13 antikoerper, kcnc1 antikoerper, kshiiid antikoerper, kv3.3 antikoerper, sca13 antikoerper, potassium voltage-gated channel subfamily C member 3 antikoerper, potassium channel, voltage gated Shaw related subfamily C, member 1 S homeolog antikoerper, potassium voltage gated channel, Shaw-related subfamily, member 3 antikoerper, potassium channel, voltage gated Shaw related subfamily C, member 3 L homeolog antikoerper, potassium voltage-gated channel, Shaw-related subfamily, member 3 antikoerper, KCNC3 antikoerper, kcnc1.S antikoerper, Kcnc3 antikoerper, kcnc3.L antikoerper
- Hintergrund
- The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. KCNC3 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.
- Molekulargewicht
- 80 kDa (MW of target protein)
-