KCNC3 Antikörper (Middle Region)

Produktnummer ABIN633709

Produktdetails anti-KCNC3 Antikörper

Target: KCNC3 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNC3 antibody was raised against the middle region of KCNC3

Aufreinigung: Affinity purified

Immunogen: KCNC3 antibody was raised using the middle region of KCNC3 corresponding to a region with amino acids YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNC3 Blocking Peptide, catalog no. 33R-10044, is also available for use as a blocking control in assays to test for specificity of this KCNC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNC3

Target: KCNC3 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3))

Andere Bezeichnung: KCNC3 (KCNC3 Produkte)

Synonyme: kcnc3-A antikoerper, Kv3.1 antikoerper, KShIIID antikoerper, Kcr2-3 antikoerper, Kv3.3 antikoerper, KSHIIID antikoerper, KV3.3 antikoerper, SCA13 antikoerper, kcnc1 antikoerper, kshiiid antikoerper, kv3.3 antikoerper, sca13 antikoerper, potassium voltage-gated channel subfamily C member 3 antikoerper, potassium channel, voltage gated Shaw related subfamily C, member 1 S homeolog antikoerper, potassium voltage gated channel, Shaw-related subfamily, member 3 antikoerper, potassium channel, voltage gated Shaw related subfamily C, member 3 L homeolog antikoerper, potassium voltage-gated channel, Shaw-related subfamily, member 3 antikoerper, KCNC3 antikoerper, kcnc1.S antikoerper, Kcnc3 antikoerper, kcnc3.L antikoerper

Hintergrund: The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. KCNC3 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Molekulargewicht: 80 kDa (MW of target protein)