CACNA1I Antikörper (Middle Region)

Produktnummer ABIN633706

Produktdetails anti-CACNA1I Antikörper

Target: CACNA1I (Calcium Channel, Voltage Dependent, T Type, alpha 1I Subunit (CACNA1I))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CACNA1I Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CACNA1 I antibody was raised against the middle region of CACNA1

Aufreinigung: Affinity purified

Immunogen: CACNA1 I antibody was raised using the middle region of CACNA1 corresponding to a region with amino acids LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CACNA1I Blocking Peptide, catalog no. 33R-5397, is also available for use as a blocking control in assays to test for specificity of this CACNA1I antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CACNA1I

Target: CACNA1I (Calcium Channel, Voltage Dependent, T Type, alpha 1I Subunit (CACNA1I))

Andere Bezeichnung: CACNA1I (CACNA1I Produkte)

Synonyme: CACNA1L antikoerper, Ca(V)3.3 antikoerper, Cav3.3 antikoerper, ca(v)3.3 antikoerper, si:ch211-51h13.1 antikoerper, Ca(v)3.3 antikoerper, calcium voltage-gated channel subunit alpha1 I antikoerper, voltage-dependent T-type calcium channel subunit alpha-1I antikoerper, calcium channel, voltage-dependent, alpha 1I subunit antikoerper, calcium channel, voltage-dependent, T type, alpha 1I subunit antikoerper, CACNA1I antikoerper, LOC100555412 antikoerper, Cacna1i antikoerper, cacna1i antikoerper

Hintergrund: Voltage-dependent calcium channels control the rapid entry of Ca(2+) into a variety of cell types and are therefore involved in both electrical and cellular signaling. T-type channels, such as CACNA1I, are activated by small membrane depolarizations and can generate burst firing and pacemaker activity.

Molekulargewicht: 245 kDa (MW of target protein)