TRPC6 Antikörper (Middle Region)

Produktnummer ABIN633705

Produktdetails anti-TRPC6 Antikörper

Target: TRPC6 (Transient Receptor Potential Cation Channel, Subfamily C, Member 6 (TRPC6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRPC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRPC6 antibody was raised against the middle region of TRPC6

Aufreinigung: Affinity purified

Immunogen: TRPC6 antibody was raised using the middle region of TRPC6 corresponding to a region with amino acids KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRPC6 Blocking Peptide, catalog no. 33R-4464, is also available for use as a blocking control in assays to test for specificity of this TRPC6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRPC6

Target: TRPC6 (Transient Receptor Potential Cation Channel, Subfamily C, Member 6 (TRPC6))

Andere Bezeichnung: TRPC6 (TRPC6 Produkte)

Synonyme: FSGS2 antikoerper, TRP6 antikoerper, AV025995 antikoerper, LLHWJM002 antikoerper, LLHWJM003 antikoerper, LLHWJM004 antikoerper, TRP-6 antikoerper, Trrp6 antikoerper, mtrp6 antikoerper, trp6 antikoerper, bZ1P14.9 antikoerper, si:rp71-1p14.9 antikoerper, trpc6 antikoerper, transient receptor potential cation channel subfamily C member 6 antikoerper, transient receptor potential cation channel, subfamily C, member 6 antikoerper, transient receptor potential cation channel, subfamily C, member 6a antikoerper, TRPC6 antikoerper, Trpc6 antikoerper, trpc6a antikoerper, trpc6 antikoerper

Hintergrund: TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).

Molekulargewicht: 106 kDa (MW of target protein)