SCN8A Antikörper (Middle Region)

Produktnummer ABIN633702

Produktdetails anti-SCN8A Antikörper

Target: SCN8A (Sodium Channel, Voltage-Gated, Type VIII, alpha (SCN8A))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCN8A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SCN8 A antibody was raised against the middle region of SCN8

Aufreinigung: Affinity purified

Immunogen: SCN8 A antibody was raised using the middle region of SCN8 corresponding to a region with amino acids ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCN8A Blocking Peptide, catalog no. 33R-2720, is also available for use as a blocking control in assays to test for specificity of this SCN8A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCN8A

Target: SCN8A (Sodium Channel, Voltage-Gated, Type VIII, alpha (SCN8A))

Andere Bezeichnung: SCN8A (SCN8A Produkte)

Synonyme: CERIII antikoerper, CIAT antikoerper, EIEE13 antikoerper, MED antikoerper, NaCh6 antikoerper, Nav1.6 antikoerper, PN4 antikoerper, AI853486 antikoerper, C630029C19Rik antikoerper, dmu antikoerper, med antikoerper, mnd-2 antikoerper, mnd2 antikoerper, nmf2 antikoerper, nmf335 antikoerper, nmf58 antikoerper, nur14 antikoerper, seal antikoerper, sodium voltage-gated channel alpha subunit 8 antikoerper, sodium channel, voltage-gated, type VIII, alpha antikoerper, SCN8A antikoerper, Scn8a antikoerper

Hintergrund: Voltage-dependent sodium channels, such as SCN8A, are responsible for the initial membrane depolarization that occurs during generation of action potentials in most electrically excitable cells.

Molekulargewicht: 225 kDa (MW of target protein)

Pathways: Sensory Perception of Sound