KCNMA1 Antikörper (Middle Region)

Produktnummer ABIN633699

Produktdetails anti-KCNMA1 Antikörper

Target: KCNMA1 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, alpha Member 1 (KCNMA1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNMA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNMA1 antibody was raised against the middle region of KCNMA1

Aufreinigung: Affinity purified

Immunogen: KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNMA1 Blocking Peptide, catalog no. 33R-2744, is also available for use as a blocking control in assays to test for specificity of this KCNMA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNMA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNMA1

Target: KCNMA1 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, alpha Member 1 (KCNMA1))

Andere Bezeichnung: KCNMA1 (KCNMA1 Produkte)

Synonyme: BKTM antikoerper, KCa1.1 antikoerper, MaxiK antikoerper, SAKCA antikoerper, SLO antikoerper, SLO-ALPHA antikoerper, SLO1 antikoerper, bA205K10.1 antikoerper, mSLO1 antikoerper, DDBDRAFT_0190653 antikoerper, DDBDRAFT_0235401 antikoerper, DDB_0190653 antikoerper, DDB_0235401 antikoerper, KCNMA antikoerper, KCNMA1 antikoerper, 5730414M22Rik antikoerper, BKCa antikoerper, Slo antikoerper, Slo1 antikoerper, mSlo antikoerper, mSlo1 antikoerper, KCNMA1b antikoerper, KCNMA1c antikoerper, Kcnma antikoerper, bktm antikoerper, kcnma1-A antikoerper, sakca antikoerper, cSlo antikoerper, slo1 antikoerper, kcnma1 antikoerper, si:ch211-39f22.2 antikoerper, BcDNA:GH10751 antikoerper, CG10693 antikoerper, Dmel\CG10693 antikoerper, Dslo antikoerper, dSlo antikoerper, dSlo1 antikoerper, dslo antikoerper, fSlo antikoerper, potassium calcium-activated channel subfamily M alpha 1 antikoerper, calcium-activated BK potassium channel, alpha subunit antikoerper, potassium large conductance calcium-activated channel, subfamily M, alpha member 1 antikoerper, potassium calcium-activated channel subfamily M alpha 1 L homeolog antikoerper, potassium large conductance calcium-activated channel, subfamily M, alpha member 1a antikoerper, calcium-activated potassium channel subunit alpha-1 antikoerper, slowpoke antikoerper, KCNMA1 antikoerper, kcnma1 antikoerper, Kcnma1 antikoerper, kcnma1.L antikoerper, kcnma1a antikoerper, LOC100454095 antikoerper, slo antikoerper

Hintergrund: This protein is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.

Molekulargewicht: 131 kDa (MW of target protein)

Pathways: Regulation of Hormone Metabolic Process, Sensory Perception of Sound