P2RX2 Antikörper (Middle Region)
-
- Target Alle P2RX2 Antikörper anzeigen
- P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser P2RX2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- P2 RX2 antibody was raised against the middle region of P2 X2
- Aufreinigung
- Affinity purified
- Immunogen
- P2 RX2 antibody was raised using the middle region of P2 X2 corresponding to a region with amino acids IRIDVIVHGQAGKFSLIPTIINLATALTSVGVVRNPLWGPSGCGGSTRPL
- Top Product
- Discover our top product P2RX2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
P2RX2 Blocking Peptide, catalog no. 33R-4132, is also available for use as a blocking control in assays to test for specificity of this P2RX2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))
- Andere Bezeichnung
- P2RX2 (P2RX2 Produkte)
- Synonyme
- DFNA41 antikoerper, P2X2 antikoerper, P2X2a antikoerper, P2x2 antikoerper, p2xr2 antikoerper, P2RX2 antikoerper, purinergic receptor P2X 2 antikoerper, purinergic receptor P2X, ligand-gated ion channel, 2 antikoerper, P2RX2 antikoerper, P2rx2 antikoerper, p2rx2 antikoerper
- Hintergrund
- P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for P2RX2.
- Molekulargewicht
- 54 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity
-