KCNV1 Antikörper (N-Term)

Produktnummer ABIN633696

Produktdetails anti-KCNV1 Antikörper

Target: KCNV1 (Potassium Channel, Subfamily V, Member 1 (KCNV1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNV1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNV1 antibody was raised against the N terminal of KCNV1

Aufreinigung: Affinity purified

Immunogen: KCNV1 antibody was raised using the N terminal of KCNV1 corresponding to a region with amino acids ALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNV1 Blocking Peptide, catalog no. 33R-1332, is also available for use as a blocking control in assays to test for specificity of this KCNV1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNV1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNV1

Target: KCNV1 (Potassium Channel, Subfamily V, Member 1 (KCNV1))

Andere Bezeichnung: KCNV1 (KCNV1 Produkte)

Synonyme: HNKA antikoerper, KCNB3 antikoerper, KV2.3 antikoerper, KV8.1 antikoerper, 2700023A03Rik antikoerper, vibe antikoerper, Kv8.1 antikoerper, potassium voltage-gated channel modifier subfamily V member 1 antikoerper, potassium channel, subfamily V, member 1 antikoerper, KCNV1 antikoerper, Kcnv1 antikoerper

Hintergrund: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNV1 is a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types.

Molekulargewicht: 56 kDa (MW of target protein)