KCNH5 Antikörper

Produktnummer ABIN633694

Produktdetails anti-KCNH5 Antikörper

Target: KCNH5 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNH5 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: KCNH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNH5 Blocking Peptide, catalog no. 33R-5485, is also available for use as a blocking control in assays to test for specificity of this KCNH5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNH5

Target: KCNH5 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5))

Andere Bezeichnung: KCNH5 (KCNH5 Produkte)

Synonyme: EAG2 antikoerper, H-EAG2 antikoerper, Kv10.2 antikoerper, hEAG2 antikoerper, Eag2 antikoerper, kcnh5 antikoerper, si:dkey-100h21.1 antikoerper, potassium voltage-gated channel subfamily H member 5 antikoerper, potassium voltage-gated channel, subfamily H (eag-related), member 5 antikoerper, potassium voltage-gated channel, subfamily H (eag-related), member 5b antikoerper, potassium voltage-gated channel, subfamily H (eag-related), member 5a antikoerper, KCNH5 antikoerper, Kcnh5 antikoerper, kcnh5b antikoerper, kcnh5a antikoerper

Hintergrund: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNH5 gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. KCNH5 is not expressed in differentiating myoblasts.

Molekulargewicht: 67 kDa (MW of target protein)