KCNG1 Antikörper (N-Term)

Produktnummer ABIN633693

Der Kaninchen Polyklonal anti-KCNG1 Antikörper (ABIN633693) detektiert spezifisch KCNG1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Maus, Human und Ratte.

Kurzübersicht für KCNG1 Antikörper (N-Term) (ABIN633693)

Target: KCNG1 (Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1))

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KCNG1 Antikörper

Bindungsspezifität: N-Term

Spezifität: KCNG1 antibody was raised against the N terminal of KCNG1

Aufreinigung: Affinity purified

Immunogen: KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNG1 Blocking Peptide, (ABIN936036), is also available for use as a blocking control in assays to test for specificity of this KCNG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNG1

Target: KCNG1 (Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1))

Andere Bezeichnung: KCNG1

Hintergrund: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Molekulargewicht: 58 kDa (MW of target protein)