KCNA10 Antikörper (N-Term)
-
- Target Alle KCNA10 Antikörper anzeigen
- KCNA10 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNA10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNA10 antibody was raised against the N terminal of KCNA10
- Aufreinigung
- Affinity purified
- Immunogen
- KCNA10 antibody was raised using the N terminal of KCNA10 corresponding to a region with amino acids DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI
- Top Product
- Discover our top product KCNA10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNA10 Blocking Peptide, catalog no. 33R-2212, is also available for use as a blocking control in assays to test for specificity of this KCNA10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNA10 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10))
- Andere Bezeichnung
- KCNA10 (KCNA10 Produkte)
- Synonyme
- cKv1.2 antikoerper, Kcn1 antikoerper, Kv1.8 antikoerper, Gm1962 antikoerper, Kcna8 antikoerper, potassium voltage-gated channel subfamily A member 10 antikoerper, potassium voltage-gated channel, shaker-related subfamily, member 10 antikoerper, KCNA10 antikoerper, Kcna10 antikoerper
- Hintergrund
- KCNA10 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KCNA2 and KCNA3 on chromosome 1.
- Molekulargewicht
- 58 kDa (MW of target protein)
-