SCN5A Antikörper (C-Term)
-
- Target Alle SCN5A Antikörper anzeigen
- SCN5A (Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SCN5A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SCN5 A antibody was raised against the C terminal of SCN5
- Aufreinigung
- Affinity purified
- Immunogen
- SCN5 A antibody was raised using the C terminal of SCN5 corresponding to a region with amino acids FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM
- Top Product
- Discover our top product SCN5A Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SCN5A Blocking Peptide, catalog no. 33R-3093, is also available for use as a blocking control in assays to test for specificity of this SCN5A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCN5A (Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A))
- Andere Bezeichnung
- SCN5A (SCN5A Produkte)
- Synonyme
- Nav1.5 antikoerper, Nav1.5c antikoerper, SkM1 antikoerper, SkM2 antikoerper, mH1 antikoerper, CDCD2 antikoerper, CMD1E antikoerper, CMPD2 antikoerper, HB1 antikoerper, HB2 antikoerper, HBBD antikoerper, HH1 antikoerper, ICCD antikoerper, IVF antikoerper, LQT3 antikoerper, PFHB1 antikoerper, SSS1 antikoerper, VF1 antikoerper, SCAL antikoerper, sodium voltage-gated channel alpha subunit 5 antikoerper, sodium channel, voltage-gated, type V, alpha antikoerper, SCN5A antikoerper, Scn5a antikoerper
- Hintergrund
- SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram.
- Molekulargewicht
- 222 kDa (MW of target protein)
-