KCND2 Antikörper (Middle Region)
-
- Target Alle KCND2 Antikörper anzeigen
- KCND2 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 2 (KCND2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCND2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCND2 antibody was raised against the middle region of KCND2
- Aufreinigung
- Affinity purified
- Immunogen
- KCND2 antibody was raised using the middle region of KCND2 corresponding to a region with amino acids RIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHL
- Top Product
- Discover our top product KCND2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCND2 Blocking Peptide, catalog no. 33R-7976, is also available for use as a blocking control in assays to test for specificity of this KCND2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCND2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCND2 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 2 (KCND2))
- Andere Bezeichnung
- KCND2 (KCND2 Produkte)
- Synonyme
- KCND2 antikoerper, si:dkey-24j9.3 antikoerper, si:dkeyp-97c5.3 antikoerper, DKFZp459P1550 antikoerper, AI839615 antikoerper, AW555701 antikoerper, Kv4.2 antikoerper, R75121 antikoerper, mKIAA1044 antikoerper, KV4.2 antikoerper, RK5 antikoerper, Shal1 antikoerper, potassium voltage-gated channel subfamily D member 2 antikoerper, potassium voltage-gated channel, Shal-related subfamily, member 2 antikoerper, potassium voltage-gated channel, Shal-related family, member 2 antikoerper, KCND2 antikoerper, kcnd2 antikoerper, Kcnd2 antikoerper, LOC101669961 antikoerper
- Hintergrund
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND2 is a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.
- Molekulargewicht
- 70 kDa (MW of target protein)
-