KCNMB4 Antikörper (Middle Region)

Produktnummer ABIN633681

Produktdetails anti-KCNMB4 Antikörper

Target: KCNMB4 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, beta Member 4 (KCNMB4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNMB4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNMB4 antibody was raised against the middle region of KCNMB4

Aufreinigung: Affinity purified

Immunogen: KCNMB4 antibody was raised using the middle region of KCNMB4 corresponding to a region with amino acids TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNMB4 Blocking Peptide, catalog no. 33R-8994, is also available for use as a blocking control in assays to test for specificity of this KCNMB4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNMB4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNMB4

Target: KCNMB4 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, beta Member 4 (KCNMB4))

Andere Bezeichnung: KCNMB4 (KCNMB4 Produkte)

Synonyme: 1700058G18Rik antikoerper, 2900045G12Rik antikoerper, kcnmb4 antikoerper, potassium calcium-activated channel subfamily M regulatory beta subunit 4 antikoerper, potassium large conductance calcium-activated channel, subfamily M, beta member 4 antikoerper, potassium channel subfamily M regulatory beta subunit 4 antikoerper, Kcnmb4 antikoerper, KCNMB4 antikoerper, kcnmb4 antikoerper

Hintergrund: KCNMB4 is the regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. KCNMB4 modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. KCNMB4 decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. KCNMB4 may decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. KCNMB4 makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations.

Molekulargewicht: 24 kDa (MW of target protein)