KCNN2 Antikörper (Middle Region)

Produktnummer ABIN633679

Produktdetails anti-KCNN2 Antikörper

Target: KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNN2 antibody was raised against the middle region of KCNN2

Aufreinigung: Affinity purified

Immunogen: KCNN2 antibody was raised using the middle region of KCNN2 corresponding to a region with amino acids KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNN2 Blocking Peptide, catalog no. 33R-4564, is also available for use as a blocking control in assays to test for specificity of this KCNN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNN2

Target: KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))

Andere Bezeichnung: KCNN2 (KCNN2 Produkte)

Synonyme: KCNN2 antikoerper, SK2 antikoerper, KCa2.2 antikoerper, SKCA2 antikoerper, SKCa 2 antikoerper, hSK2 antikoerper, fri antikoerper, potassium calcium-activated channel subfamily N member 2 antikoerper, potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 antikoerper, KCNN2 antikoerper, Kcnn2 antikoerper

Hintergrund: KCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.

Molekulargewicht: 26 kDa (MW of target protein)