KCTD4 Antikörper (Middle Region)
-
- Target Alle KCTD4 Antikörper anzeigen
- KCTD4 (BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCTD4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCTD4 antibody was raised against the middle region of KCTD4
- Aufreinigung
- Affinity purified
- Immunogen
- KCTD4 antibody was raised using the middle region of KCTD4 corresponding to a region with amino acids EITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNI
- Top Product
- Discover our top product KCTD4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCTD4 Blocking Peptide, catalog no. 33R-2487, is also available for use as a blocking control in assays to test for specificity of this KCTD4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCTD4 (BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4))
- Andere Bezeichnung
- KCTD4 (KCTD4 Produkte)
- Synonyme
- bA321C24.3 antikoerper, 2210017A09Rik antikoerper, AU017169 antikoerper, wu:fk37b10 antikoerper, zgc:92463 antikoerper, potassium channel tetramerization domain containing 4 antikoerper, potassium channel tetramerisation domain containing 4 antikoerper, KCTD4 antikoerper, Kctd4 antikoerper, kctd4 antikoerper
- Hintergrund
- KCTD4 contains 1 BTB (POZ) domain. The exact function of KCTD4 remains unknown.
- Molekulargewicht
- 30 kDa (MW of target protein)
-