CACNB4 Antikörper (Middle Region)
-
- Target Alle CACNB4 Antikörper anzeigen
- CACNB4 (Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CACNB4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CACNB4 antibody was raised against the middle region of CACNB4
- Aufreinigung
- Affinity purified
- Immunogen
- CACNB4 antibody was raised using the middle region of CACNB4 corresponding to a region with amino acids GVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPVPHILASSRQWDP
- Top Product
- Discover our top product CACNB4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CACNB4 Blocking Peptide, catalog no. 33R-3649, is also available for use as a blocking control in assays to test for specificity of this CACNB4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNB4 (Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4))
- Andere Bezeichnung
- CACNB4 (CACNB4 Produkte)
- Synonyme
- CAB4 antikoerper, CACNLB4 antikoerper, EA5 antikoerper, EIG9 antikoerper, EJM antikoerper, EJM4 antikoerper, EJM6 antikoerper, 3110038O15Rik antikoerper, Cchb4 antikoerper, lethargic antikoerper, lh antikoerper, CACNB4 antikoerper, cacnb4.2 antikoerper, calcium voltage-gated channel auxiliary subunit beta 4 antikoerper, calcium channel, voltage-dependent, beta 4 subunit antikoerper, calcium channel, voltage-dependent, beta 4a subunit antikoerper, CACNB4 antikoerper, Cacnb4 antikoerper, cacnb4.1 antikoerper, cacnb4 antikoerper, cacnb4a antikoerper
- Hintergrund
- CACNB4 is a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. CACNB4 plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME).
- Molekulargewicht
- 50 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process, Skeletal Muscle Fiber Development
-