TOMM40L Antikörper

Produktnummer ABIN633628

Produktdetails anti-TOMM40L Antikörper

Target: TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TOMM40L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TOMM40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TOMM40L Blocking Peptide, catalog no. 33R-5217, is also available for use as a blocking control in assays to test for specificity of this TOMM40L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOMM40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TOMM40L

Target: TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))

Andere Bezeichnung: TOMM40L (TOMM40L Produkte)

Synonyme: RP11-297K8.10 antikoerper, TOMM40B antikoerper, Tom40B antikoerper, RGD1562006 antikoerper, Tomm40b antikoerper, zgc:85715 antikoerper, translocase of outer mitochondrial membrane 40 like antikoerper, translocase of outer mitochondrial membrane 40 homolog-like (yeast) antikoerper, translocase of outer mitochondrial membrane 40 homolog, like antikoerper, TOMM40L antikoerper, Tomm40l antikoerper, tomm40l antikoerper

Hintergrund: TOMM40L is a potential channel-forming protein implicated in import of protein precursors into mitochondria.

Molekulargewicht: 34 kDa (MW of target protein)