VDAC2 Antikörper (N-Term)
-
- Target Alle VDAC2 Antikörper anzeigen
- VDAC2 (Voltage-Dependent Anion Channel 2 (VDAC2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VDAC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- VDAC2 antibody was raised against the N terminal of VDAC2
- Aufreinigung
- Affinity purified
- Immunogen
- VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN
- Top Product
- Discover our top product VDAC2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VDAC2 Blocking Peptide, catalog no. 33R-9629, is also available for use as a blocking control in assays to test for specificity of this VDAC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VDAC2 (Voltage-Dependent Anion Channel 2 (VDAC2))
- Andere Bezeichnung
- VDAC2 (VDAC2 Produkte)
- Synonyme
- POR antikoerper, Vdac6 antikoerper, mVDAC2 antikoerper, mVDAC6 antikoerper, wu:fa01a08 antikoerper, wu:fa98a10 antikoerper, wu:fb50g11 antikoerper, zgc:55795 antikoerper, zgc:77621 antikoerper, vdac2 antikoerper, VDAC2 antikoerper, ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 2 antikoerper, ATVDAC2 antikoerper, K9I9.6 antikoerper, K9I9_6 antikoerper, voltage dependent anion channel 2 antikoerper, voltage dependent anion channel 2 antikoerper, voltage-dependent anion channel 2 antikoerper, voltage-dependent anion channel 2 S homeolog antikoerper, VDAC2 antikoerper, Vdac2 antikoerper, vdac2 antikoerper, vdac2.S antikoerper
- Hintergrund
- VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.
- Molekulargewicht
- 31 kDa (MW of target protein)
-