SRPR Antikörper
-
- Target Alle SRPR Antikörper anzeigen
- SRPR (Signal Recognition Particle Receptor (Docking Protein) (SRPR))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SRPR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SRPR antibody was raised using a synthetic peptide corresponding to a region with amino acids EEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTP
- Top Product
- Discover our top product SRPR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SRPR Blocking Peptide, catalog no. 33R-2356, is also available for use as a blocking control in assays to test for specificity of this SRPR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRPR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRPR (Signal Recognition Particle Receptor (Docking Protein) (SRPR))
- Andere Bezeichnung
- SRPR (SRPR Produkte)
- Synonyme
- sralpha antikoerper, srp-alpha antikoerper, 1300011P19Rik antikoerper, D11Mgi27 antikoerper, DP antikoerper, Sralpha antikoerper, SRP receptor alpha subunit antikoerper, signal recognition particle receptor (docking protein) antikoerper, signal recognition particle receptor subunit alpha antikoerper, signal recognition particle receptor antikoerper, signal recognition particle receptor (Docking protein) antikoerper, signal recognition particle receptor ('docking protein') antikoerper, srpra antikoerper, ftsY antikoerper, Tb11.01.1650 antikoerper, STER_1399 antikoerper, CMU_011790 antikoerper, EUBELI_01057 antikoerper, MGYG_00278 antikoerper, Tsp_06333 antikoerper, Srpr antikoerper, Srpra antikoerper, SRPRA antikoerper
- Hintergrund
- SRPR belongs to the GTP-binding SRP family. It is in conjunction with SRP, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.
- Molekulargewicht
- 70 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-