Ribonuclease H1 Antikörper (Middle Region)

Produktnummer ABIN633594

Produktdetails anti-Ribonuclease H1 Antikörper

Target: Ribonuclease H1 (RNASEH1)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Ribonuclease H1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNASEH1 antibody was raised against the middle region of RNASEH1

Aufreinigung: Affinity purified

Immunogen: RNASEH1 antibody was raised using the middle region of RNASEH1 corresponding to a region with amino acids EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNASEH1 Blocking Peptide, catalog no. 33R-2790, is also available for use as a blocking control in assays to test for specificity of this RNASEH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Ribonuclease H1

Target: Ribonuclease H1 (RNASEH1)

Andere Bezeichnung: RNASEH1 (RNASEH1 Produkte)

Synonyme: H1RNA antikoerper, RNH1 antikoerper, 74/9 antikoerper, CG8729 antikoerper, Dmel\\CG8729 antikoerper, RNase H1 antikoerper, RnH1 antikoerper, l(2)43F1-5 antikoerper, l(2)43Fa antikoerper, l(2)k07409 antikoerper, l(2)k07624 antikoerper, rnhl antikoerper, h1rna antikoerper, rnh1 antikoerper, zgc:91971 antikoerper, RNASEH1P1 antikoerper, RNASEH1 antikoerper, rnaseh1 antikoerper, Afu1g10020 antikoerper, Tb07.26A24.40 antikoerper, ribonuclease H1 antikoerper, ribonuclease H1 S homeolog antikoerper, ribonuclease H1 L homeolog antikoerper, ribonuclease HI antikoerper, Ribonuclease H1 antikoerper, RNASEH1 antikoerper, Rnaseh1 antikoerper, rnh1 antikoerper, rnaseh1.S antikoerper, rnaseh1 antikoerper, rnaseh1.L antikoerper, AFUA_1G10020 antikoerper, Tb927.7.4930 antikoerper, APH_RS00510 antikoerper

Hintergrund: RNASEH1 belongs to the RNase H family. It contains 1 RNase H domain. RNASEH1 is an endonuclease that specifically degrades the RNA of RNA-DNA hybrids.

Molekulargewicht: 32 kDa (MW of target protein)