EIF4E3 Antikörper (Middle Region)

Produktnummer ABIN633584

Produktdetails anti-EIF4E3 Antikörper

Target: EIF4E3 (Eukaryotic Translation Initiation Factor 4E Family Member 3 (EIF4E3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF4E3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF4 E3 antibody was raised against the middle region of EIF4 3

Aufreinigung: Affinity purified

Immunogen: EIF4 E3 antibody was raised using the middle region of EIF4 3 corresponding to a region with amino acids VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF4E3 Blocking Peptide, catalog no. 33R-9766, is also available for use as a blocking control in assays to test for specificity of this EIF4E3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF4E3

Target: EIF4E3 (Eukaryotic Translation Initiation Factor 4E Family Member 3 (EIF4E3))

Andere Bezeichnung: EIF4E3 (EIF4E3 Produkte)

Synonyme: eif4e3 antikoerper, wu:fc31f11 antikoerper, wu:fd15f11 antikoerper, zgc:92189 antikoerper, DDBDRAFT_0191035 antikoerper, DDBDRAFT_0234256 antikoerper, DDB_0191035 antikoerper, DDB_0234256 antikoerper, IF4E3 antikoerper, 1300018P11Rik antikoerper, AI451927 antikoerper, eIF4E-3 antikoerper, eukaryotic translation initiation factor 4E family member 3 antikoerper, eukaryotic translation initiation factor 4E family member 3 L homeolog antikoerper, eukaryotic translation initiation factor 4E member 3 antikoerper, eukaryotic translation initiation factor 4E family member 3 S homeolog antikoerper, EIF4E3 antikoerper, Eif4e3 antikoerper, eif4e3.L antikoerper, eif4e3 antikoerper, eIF4e3 antikoerper, eif4e3.S antikoerper

Hintergrund: EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.

Molekulargewicht: 24 kDa (MW of target protein)