BCAS2 Antikörper (N-Term)

Produktnummer ABIN633573

Dieses Anti-BCAS2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von BCAS2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für BCAS2 Antikörper (N-Term) (ABIN633573)

Target: BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BCAS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BCAS2 Antikörper

Bindungsspezifität: N-Term

Spezifität: BCAS2 antibody was raised against the N terminal of BCAS2

Aufreinigung: Affinity purified

Immunogen: BCAS2 antibody was raised using the N terminal of BCAS2 corresponding to a region with amino acids MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BCAS2 Blocking Peptide, (ABIN5612290), is also available for use as a blocking control in assays to test for specificity of this BCAS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BCAS2

Target: BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))

Andere Bezeichnung: BCAS2

Hintergrund: BCAS2 belongs to the SPF27 family. It is involved in mRNA splicing. The protein might play an important role in breast cancer development by increasing the estrogen receptor's function.

Molekulargewicht: 26 kDa (MW of target protein)